PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00065.51
Common NameAMTR_s00065p00092420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family GRF
Protein Properties Length: 626aa    MW: 67209.1 Da    PI: 8.7961
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00065.51genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.13.5e-24243286144
                                      WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                              d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e
  evm_27.model.AmTr_v1.0_scaffold00065.51 243 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKPVE 286
                                              79***************************************998 PP

2QLQ48.92e-17173208136
                                      QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                                              ++FT++Q+ +L++Q+l++K+L  ++P+P++Ll  ++
  evm_27.model.AmTr_v1.0_scaffold00065.51 173 GPFTPSQWIELEHQALIFKHLTTGAPIPANLLISLR 208
                                              59******************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.0E-8173209IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.8E-12174206IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.031174209IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.663243287IPR014977WRC domain
PfamPF088797.5E-21244286IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 626 aa     Download sequence    Send to blast
MDFVGVDGLG FLGTSETGFS CSGFEFESKQ KDNGFGSGCL KQGRSGSDEE WRSFKMARRE  60
DYSASKAMVA QQQRPTLLRS NSLYPDAQFA YSLSRTESGQ LCYSSLSRTE NGQLGYSSLS  120
KTDNGGAFFS SDGISTTTPA LPFYQSTPYT KNTGLISGSS NGNMHGVMTG VRGPFTPSQW  180
IELEHQALIF KHLTTGAPIP ANLLISLRKT LNPSGFPSYS AGSLRPNSLG WGSFHLGFSG  240
NSDPEPGRCR RTDGKKWRCS RDAVADQKYC ERHMNRGRHR SRKPVEGHTN GHASSSLPKT  300
ITTNSTTTST TMAKSLTSSL NVTVSNGGGS SLAVVNQMKS LPVSESSLPA SQFDRFMINK  360
AKFDEHQGLS MVSSIGLRPK APSFPLPKQN LPSDFGLISS KNLLNPSRNS YLHSRNFIDG  420
WPKTCSEPEE RTQLSISIPV ASSDFSSSSS SPTQESASLS PLKLSRDVDL FQMGLGVGPL  480
NETCNRQANL LPISWETSMG GPLAEVLNST NNPKDCKSNS SSALNLMGES WEMSPRMGSS  540
PTGVLQKAFG SLSNSSTGSS PRAENKAQHE STSLCDDLFV STFVNSSSIP SFLLKKQACI  600
SSGQFCAGFQ LIPVISVCVD PAAYL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0422958e-36KF042295.1 Bauhinia purpurea GRF2 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011628017.10.0PREDICTED: growth-regulating factor 6
TrEMBLU5DAV70.0U5DAV7_AMBTC; Uncharacterized protein
STRINGVIT_18s0001g08650.t011e-170(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP33571226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.17e-71growth-regulating factor 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]